PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10013546m
Common NameCARUB_v10013546mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 490aa    MW: 53696.6 Da    PI: 7.2252
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10013546mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY92.63e-29131189160
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      ++DgynWrKYGqK vkg+ef rsYYrCt+++C++kk++ers   ++vv+++Y  eH+h+k
  Carubv10013546m 131 MEDGYNWRKYGQKLVKGNEFVRSYYRCTYPNCKAKKQLERSP-GGQVVDTVYFAEHDHPK 189
                      58****************************************.***************85 PP

2WRKY106.41.5e-33303361159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ++Dgy+WrKYGqK+vkgs++prsYYrC+s+gCpvkk+vers++d+k++++tYeg+H+h 
  Carubv10013546m 303 VNDGYRWRKYGQKSVKGSPYPRSYYRCSSSGCPVKKHVERSSQDTKLLITTYEGKHDHA 361
                      58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081121.987126190IPR003657WRKY domain
SuperFamilySSF1182905.75E-24127190IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-25127190IPR003657WRKY domain
SMARTSM007749.3E-33131189IPR003657WRKY domain
PfamPF031068.8E-23132188IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.4E-34290363IPR003657WRKY domain
SuperFamilySSF1182902.88E-28297363IPR003657WRKY domain
PROSITE profilePS5081134.13298363IPR003657WRKY domain
SMARTSM007741.8E-38303362IPR003657WRKY domain
PfamPF031062.0E-26304360IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MAEVDKVPVS DMELDGSSET KAAVDGVVVA DKTEATSVTV TRTDVVLADK TEATPVTVTR  60
TEVVVEGCQT ESSKSVDCKE QLVPQITASQ SEVDVASPTS EKAPKVSESS TVLSLQSTSE  120
GNSPFIREKV MEDGYNWRKY GQKLVKGNEF VRSYYRCTYP NCKAKKQLER SPGGQVVDTV  180
YFAEHDHPKP PTGAVSISQD KRSDVVTAVS KEKSSGSLVQ TPRQTEPPKV HRGLHISVTP  240
AADDVKTDIS QSSRIKGDNT HKDLSSPSSK RRKKGGNIEP SPVERPTSDS RNVVHTQTLF  300
DIVNDGYRWR KYGQKSVKGS PYPRSYYRCS SSGCPVKKHV ERSSQDTKLL ITTYEGKHDH  360
AMPPGRVVTH NNMVDSEVDD KEQNAKEGDA NKTPQSAALQ SITKDQHEED HPRKKIKTNG  420
FEKSLGQGPV LDEKVKEEIK DISDANKDHA ANHAKPETKS EDKIAACHEK AVGTLETEEQ  480
KPKTEPAQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-46130365176WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297523.10.0hypothetical protein CARUB_v10013546mg
SwissprotQ9SI370.0WRKY1_ARATH; WRKY transcription factor 1
TrEMBLR0G4V60.0R0G4V6_9BRAS; Uncharacterized protein
STRINGAT2G04880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79492639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.20.0zinc-dependent activator protein-1